Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc35c2 Peptide - C-terminal region

Slc35c2 Peptide - C-terminal region

Product Specifications

UniProt

Q3U226

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35C2 Rabbit Polyclonal Antibody (orb578999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QKI CRISPRa sgRNA lentivector (set of three targets)(Human)
38265121 3x 1.0µg DNA

QKI CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
IN-1130
BA9153-100 100 mg

IN-1130

Sign In for Pricing
View Details
Cattle CP (Ceruloplasmin) ELISA Kit
ELK9158-01 48 Tests

Cattle CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details
Cattle CP (Ceruloplasmin) ELISA Kit
ELK9158-02 96 Tests

Cattle CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details
Cattle CP (Ceruloplasmin) ELISA Kit
ELK9158-03 5x 96 Tests

Cattle CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bovine Propionyl-CoA carboxylase beta chain, mitochondrial (PCCB) , partial
MBS1386973 Inquire

Recombinant Bovine Propionyl-CoA carboxylase beta chain, mitochondrial (PCCB) , partial

Sign In for Pricing
View Details