Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc35c2 Peptide - C-terminal region

Slc35c2 Peptide - C-terminal region

Product Specifications

UniProt

Q3U226

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35C2 Rabbit Polyclonal Antibody (orb578999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Auh 3'UTR Luciferase Stable Cell Line
TU201142 1.0 mL

Auh 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Fam183b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
19864114 3x 1.0 µg

Fam183b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-human TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa polyclonal Antibody
MBS714297-01 0.1 mL

Rabbit anti-human TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa polyclonal Antibody
MBS714297-02 5x 0.1 mL

Rabbit anti-human TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa polyclonal Antibody

Sign In for Pricing
View Details
ASPG siRNA Oligos set (Human)
12561171 3x 5 nmol

ASPG siRNA Oligos set (Human)

Sign In for Pricing
View Details
1700019A02Rik (NM_027070) Mouse Tagged ORF Clone Lentiviral Particle
MR214585L3V 200 µL

1700019A02Rik (NM_027070) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details