Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc36a4 Peptide - N-terminal region

Slc36a4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6330573I15Rik, PAT4

UniProt

Q8CH36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc36a4 Rabbit Polyclonal Antibody (orb325126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758493

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ncald sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6588105 3x 1.0 µg

Ncald sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MRGPRX3 Antibody (N-term)
MBS9205920-01 0.08 mL

MRGPRX3 Antibody (N-term)

Sign In for Pricing
View Details
MRGPRX3 Antibody (N-term)
MBS9205920-02 0.4 mL

MRGPRX3 Antibody (N-term)

Sign In for Pricing
View Details
MRGPRX3 Antibody (N-term)
MBS9205920-03 5x 0.4 mL

MRGPRX3 Antibody (N-term)

Sign In for Pricing
View Details
HACE1 (NM_020771) Human Tagged ORF Clone Lentiviral Particle
RC205602L4V 200 µL

HACE1 (NM_020771) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD80 (B7-1)
216333 100 µg

CD80 (B7-1)

Sign In for Pricing
View Details