Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT8 Peptide - N-terminal region

CCT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C21orf112, Cctq, D21S246, PRED71

UniProt

P50990

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCT8 Rabbit Polyclonal Antibody (orb579588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006576

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Aspartic acid discontinued. See A3880-15
258497-01 500 g

DL-Aspartic acid discontinued. See A3880-15

Sign In for Pricing
View Details
DL-Aspartic acid discontinued. See A3880-15
258497-02 1 Kg

DL-Aspartic acid discontinued. See A3880-15

Sign In for Pricing
View Details
DL-Aspartic acid discontinued. See A3880-15
258497-03 2 Kg

DL-Aspartic acid discontinued. See A3880-15

Sign In for Pricing
View Details
DL-Aspartic acid discontinued. See A3880-15
258497-04 5 Kg

DL-Aspartic acid discontinued. See A3880-15

Sign In for Pricing
View Details
DL-Aspartic acid discontinued. See A3880-15
258497-05 10 Kg

DL-Aspartic acid discontinued. See A3880-15

Sign In for Pricing
View Details
Mouse Monoclonal CD34 Antibody (4H11[APG]) [DyLight 550]
NB500-608R-0.1mL 0.1 mL

Mouse Monoclonal CD34 Antibody (4H11[APG]) [DyLight 550]

Sign In for Pricing
View Details