Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT8 Peptide - N-terminal region

CCT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C21orf112, Cctq, D21S246, PRED71

UniProt

P50990

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCT8 Rabbit Polyclonal Antibody (orb579588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006576

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SB 772077B dihydrochloride
B5529-10 10 mg

SB 772077B dihydrochloride

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)
S0B3009-01 0.1 mg

SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)
S0B3009-02 0.5 mg

SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)
S0B3009-03 10 mg

SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)
S0B3009-04 1 mg

SARS-CoV-2 Nucleocapsid Protein Recombinant Rabbit mAb (SDT-021-30)

Sign In for Pricing
View Details
ANGPTL7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
11903061 1.0 µg DNA

ANGPTL7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details