Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINS4 Peptide - N-terminal region

GINS4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLD5

UniProt

Q9BRT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_115712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD3G Antibody
RC-15916-01 50 μL

Recombinant CD3G Antibody

Sign In for Pricing
View Details
Recombinant CD3G Antibody
RC-15916-02 100 µL

Recombinant CD3G Antibody

Sign In for Pricing
View Details
Recombinant CD3G Antibody
RC-15916-03 1 mL

Recombinant CD3G Antibody

Sign In for Pricing
View Details
Helicobacter pylori (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680374-100 1x 100 µL

Helicobacter pylori (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uhmk1 Mouse Gene Knockout Kit (CRISPR)
KN518684 1 Kit

Uhmk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IER3IP1 Human Gene Knockout Kit (CRISPR)
KN403042 1 Kit

IER3IP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details