Bsx Peptide - middle region
Bsx Peptide - middle region
Product Specifications
Product Name Alternative
Bsx1a, Bsx1b
UniProt
Q810B3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Bsx Rabbit Polyclonal Antibody (orb580219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_839976
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
IT-300-156M2-01 0.1 mg
Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215
Sign In for Pricing
View Details IT-300-156M2-02 0.5 mg
Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215
Sign In for Pricing
View Details