Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT9 Peptide - C-terminal region

NAT9 Peptide - C-terminal region

Product Specifications

UniProt

Q9BTE0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT9 Rabbit Polyclonal Antibody (orb580520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccrl2 Mouse Gene Knockout Kit (CRISPR)
KN502843 1 Kit

Ccrl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rb (RB1) pSer249 Rabbit Polyclonal Antibody
AP12694PU-N 400 µL

Rb (RB1) pSer249 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGI3 Polyclonal Antibody
E-AB-68033-01 60 µL

MAGI3 Polyclonal Antibody

Sign In for Pricing
View Details
MAGI3 Polyclonal Antibody
E-AB-68033-02 120 µL

MAGI3 Polyclonal Antibody

Sign In for Pricing
View Details
MAGI3 Polyclonal Antibody
E-AB-68033-03 200 µL

MAGI3 Polyclonal Antibody

Sign In for Pricing
View Details
Prss3 Mouse Gene Knockout Kit (CRISPR)
KN514031 1 Kit

Prss3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details