MGARP Peptide - C-terminal region
MGARP Peptide - C-terminal region
Product Specifications
Product Name Alternative
C4orf49, CESP-1, HUMMR, OSAP
UniProt
Q8TDB4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MGARP Rabbit Polyclonal Antibody (orb325547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116012
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![VIP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]](https://cdn.genprice.uk/products/937/68dd1b7d061270361ea1d39a/imageurl/ta806856bm.webp)
TA806856BM 100 µL
VIP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
Sign In for Pricing
View Details ![DDIT3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C4]](https://cdn.genprice.uk/products/937/68dd1b77061270361ea1af3a/imageurl/ta802207bm.webp)
TA802207BM 100 µL
DDIT3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C4]
Sign In for Pricing
View Details 
![FITC Anti-Human CD5 Antibody[5D7]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d3331/imageurl/e-ab-f1371c.webp)