Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRVI1 Peptide - N-terminal region

MRVI1 Peptide - N-terminal region

Product Specifications

UniProt

Q9Y6F6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRVI1 Rabbit Polyclonal Antibody (orb581038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHMT1 Antibody
KC-2018-01 50 μL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-2018-02 100 µL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-2018-03 1 mL

SHMT1 Antibody

Sign In for Pricing
View Details
COX11 Antibody
8C12229-AAT 50 µg

COX11 Antibody

Sign In for Pricing
View Details
eNOS (NOS3) pThr494 Rabbit Polyclonal Antibody
AP01888PU-N 100 µg

eNOS (NOS3) pThr494 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/1516), 1mg/mL
BNUM1516-50 1x 50 µL

FOXA1 / HNF3A (FOXA1/1516), 1mg/mL

Sign In for Pricing
View Details