MRVI1 Peptide - N-terminal region
MRVI1 Peptide - N-terminal region
Product Specifications
UniProt
Q9Y6F6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRVI1 Rabbit Polyclonal Antibody (orb581038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC436781 20 µg
p53 (TP53) (NM_001276697) Human Over-expression Lysate
Sign In for Pricing
View Details 
![Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d406b/imageurl/e-ab-f1050l.webp)
E-AB-F1050L-01 20 Tests
Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]
Sign In for Pricing
View Details