Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPSM2 Peptide - N-terminal region

GPSM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CMCS, DFNB82, LGN, PINS

UniProt

P81274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPSM2 Rabbit Polyclonal Antibody (orb330633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037428

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 shRNA Plasmid (m)
sc-35478-SH 20 µg

GIT1 shRNA Plasmid (m)

Sign In for Pricing
View Details
GATAD2B antibody
FNab03366 100 µg

GATAD2B antibody

Sign In for Pricing
View Details
Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)
MBS7039343-01 0.02 mg

Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)

Sign In for Pricing
View Details
Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)
MBS7039343-02 0.1 mg

Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)

Sign In for Pricing
View Details
Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)
MBS7039343-03 5x 0.1 mg

Recombinant Proteus mirabilis UPF0756 membrane protein PMI1560 (PMI1560)

Sign In for Pricing
View Details
Agphd1 sgRNA CRISPR Lentivector set (Mouse)
K3241601 3x 1.0 µg

Agphd1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details