Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPSM2 Peptide - N-terminal region

GPSM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CMCS, DFNB82, LGN, PINS

UniProt

P81274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPSM2 Rabbit Polyclonal Antibody (orb330633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037428

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPF (ERCC4) Mouse Monoclonal Antibody [Clone ID: LBI2A1]
AMM11597V 100 µL

XPF (ERCC4) Mouse Monoclonal Antibody [Clone ID: LBI2A1]

Sign In for Pricing
View Details
Human CT47A1 activation kit by CRISPRa
GA118908 1 Kit

Human CT47A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Phosphodiesterase 6H (PDE6H) ELISA Kit
abx507536 96 Tests

Mouse Phosphodiesterase 6H (PDE6H) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin type III and SPRY domain containing protein 2 (FSD2) ELISA Kit
GTR10348694 96 Well

Mouse Fibronectin type III and SPRY domain containing protein 2 (FSD2) ELISA Kit

Sign In for Pricing
View Details
Pefloxacin mesylate
54165700-25g 25 g

Pefloxacin mesylate

Sign In for Pricing
View Details
ABHD15 sgRNA CRISPR Lentivector (Human) (Target 3)
K0023404 1.0 µg DNA

ABHD15 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details