Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF562 Peptide - C-terminal region

ZNF562 Peptide - C-terminal region

Product Specifications

UniProt

F5H1B4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF562 Rabbit Polyclonal Antibody (orb581393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit
MBS7217450-01 48 Well

Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit

Sign In for Pricing
View Details
Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit
MBS7217450-02 96 Well

Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit

Sign In for Pricing
View Details
Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit
MBS7217450-03 5x 96 Well

Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit

Sign In for Pricing
View Details
Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit
MBS7217450-04 10x 96 Well

Sheep Cell death activator CIDE-A (CIDEA) ELISA Kit

Sign In for Pricing
View Details
POU1F1 Rabbit pAb
MBS9143129-01 0.02 mL

POU1F1 Rabbit pAb

Sign In for Pricing
View Details
POU1F1 Rabbit pAb
MBS9143129-02 0.1 mL

POU1F1 Rabbit pAb

Sign In for Pricing
View Details