CCDC116 Peptide - C-terminal region
CCDC116 Peptide - C-terminal region
Product Specifications
UniProt
Q8IYX3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC116 Rabbit Polyclonal Antibody (orb581933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689825
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQQEPATHTAQDQATEPCRSLYTNLPASRQLSPLEPKLYMSACTGMGSSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ZFP200 (ZNF200) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]](https://cdn.genprice.uk/products/937/68dd1b80061270361ea1e00b/imageurl/ta808254am.webp)
TA808254AM 100 µL
ZFP200 (ZNF200) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
Sign In for Pricing
View Details ![PON3 Mouse Monoclonal Antibody [Clone ID: OTI1F12]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90807b/imageurl/cf807353.webp)
