Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC116 Peptide - C-terminal region

CCDC116 Peptide - C-terminal region

Product Specifications

UniProt

Q8IYX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC116 Rabbit Polyclonal Antibody (orb581933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689825

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQQEPATHTAQDQATEPCRSLYTNLPASRQLSPLEPKLYMSACTGMGSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MEF2BNB (BORCS8) activation kit by CRISPRa
GA119034 1 Kit

Human MEF2BNB (BORCS8) activation kit by CRISPRa

Sign In for Pricing
View Details
HMGB1 Antibody
8C10316-AAT 50 µg

HMGB1 Antibody

Sign In for Pricing
View Details
DKK1 Antibody
KC-2424-01 50 μL

DKK1 Antibody

Sign In for Pricing
View Details
DKK1 Antibody
KC-2424-02 100 µL

DKK1 Antibody

Sign In for Pricing
View Details
DKK1 Antibody
KC-2424-03 1 mL

DKK1 Antibody

Sign In for Pricing
View Details
Isopropyl 5-(Diphenylphosphoryl)pentanoate
TRC-I824450-25MG 25 mg

Isopropyl 5-(Diphenylphosphoryl)pentanoate

Sign In for Pricing
View Details