Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFB Peptide - C-terminal region

ETFB Peptide - C-terminal region

Product Specifications

Product Name Alternative

MADD

UniProt

P38117

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETFB Rabbit Polyclonal Antibody (orb330752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001976

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAI2 Polyclonal Antibody
MBS2561341-01 0.02 mL

GNAI2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAI2 Polyclonal Antibody
MBS2561341-02 0.06 mL

GNAI2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAI2 Polyclonal Antibody
MBS2561341-03 0.12 mL

GNAI2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAI2 Polyclonal Antibody
MBS2561341-04 0.2 mL

GNAI2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAI2 Polyclonal Antibody
MBS2561341-05 5x 0.2 mL

GNAI2 Polyclonal Antibody

Sign In for Pricing
View Details
C1s Rabbit Polyclonal Antibody
E28PT0567 100 µL

C1s Rabbit Polyclonal Antibody

Sign In for Pricing
View Details