Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hebp2 Peptide - N-terminal region

Hebp2 Peptide - N-terminal region

Product Specifications

UniProt

D3ZHC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hebp2 Rabbit Polyclonal Antibody (orb582590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPEP1 siRNA (Human)
orb1867006-01 15 nmol

DPEP1 siRNA (Human)

Sign In for Pricing
View Details
DPEP1 siRNA (Human)
orb1867006-02 30 nmol

DPEP1 siRNA (Human)

Sign In for Pricing
View Details
SPTLC1 Blocking Peptide
33R-3905 0.1 mg

SPTLC1 Blocking Peptide

Sign In for Pricing
View Details
ApoC3 Human Monoclonal Antibody
orb2956885-01 100 µg

ApoC3 Human Monoclonal Antibody

Sign In for Pricing
View Details
ApoC3 Human Monoclonal Antibody
orb2956885-02 1 mg

ApoC3 Human Monoclonal Antibody

Sign In for Pricing
View Details
Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit
RD-CRTC3-Hu-96Tests 96 Tests

Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details