Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hebp2 Peptide - N-terminal region

Hebp2 Peptide - N-terminal region

Product Specifications

UniProt

D3ZHC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hebp2 Rabbit Polyclonal Antibody (orb582590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suppressin shRNA Plasmid (h)
sc-76613-SH 20 µg

Suppressin shRNA Plasmid (h)

Sign In for Pricing
View Details
HoxD9 HDR Plasmid (h)
sc-404606-HDR 20 µg

HoxD9 HDR Plasmid (h)

Sign In for Pricing
View Details
cis-Vaccenic acid (Standard)
HY-113427AR Inquire

cis-Vaccenic acid (Standard)

Sign In for Pricing
View Details
Olfr727 CRISPR Activation Plasmid (m)
sc-434475-ACT 20 µg

Olfr727 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Ambroxol Cyclic Impurity Hydrochloride
TRC-A575910-100MG 100 mg

Ambroxol Cyclic Impurity Hydrochloride

Sign In for Pricing
View Details
Alpha-Chlordane 2000 Î1⁄4g/mL in hexane: toluene (1:1)
CS-O-43250 1 Each

Alpha-Chlordane 2000 Î1⁄4g/mL in hexane: toluene (1:1)

Sign In for Pricing
View Details