Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hebp2 Peptide - N-terminal region

Hebp2 Peptide - N-terminal region

Product Specifications

UniProt

D3ZHC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hebp2 Rabbit Polyclonal Antibody (orb582590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ATP1b3 ELISA Kit
E075984 1 Each

Rat ATP1b3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans cysS Protein (aa 1-468)
VAng-Yyj4048-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Ulcerans cysS Protein (aa 1-468)

Sign In for Pricing
View Details
CAMKK2 Antibody Blocking peptide
orb1447054 500 µg

CAMKK2 Antibody Blocking peptide

Sign In for Pricing
View Details
NKPD1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04695 0.1 mg

NKPD1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
NVP-QAV-572 100mg
A16273-100 100 mg

NVP-QAV-572 100mg

Sign In for Pricing
View Details
M-PEG6-CH2CH2CHO
T15913-01 5 mg

M-PEG6-CH2CH2CHO

Sign In for Pricing
View Details