Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hebp2 Peptide - N-terminal region

Hebp2 Peptide - N-terminal region

Product Specifications

UniProt

D3ZHC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hebp2 Rabbit Polyclonal Antibody (orb582590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fusidic Acid Sodium Salt
TRC-F865505-1G 1 g

Fusidic Acid Sodium Salt

Sign In for Pricing
View Details
PPP2CA (pY307) Blocking Peptide
MBS823427-01 1 mg

PPP2CA (pY307) Blocking Peptide

Sign In for Pricing
View Details
PPP2CA (pY307) Blocking Peptide
MBS823427-02 5 mg

PPP2CA (pY307) Blocking Peptide

Sign In for Pricing
View Details
PPP2CA (pY307) Blocking Peptide
MBS823427-03 5x 5 mg

PPP2CA (pY307) Blocking Peptide

Sign In for Pricing
View Details
Activin Receptor Type IIA (Activin Receptor Type-2A, Activin Receptor Type IIA, ACTR-IIA, ACTRIIA, ACVR2A, ACVR2) (APC)
MBS6002407-01 100 Tests

Activin Receptor Type IIA (Activin Receptor Type-2A, Activin Receptor Type IIA, ACTR-IIA, ACTRIIA, ACVR2A, ACVR2) (APC)

Sign In for Pricing
View Details
Activin Receptor Type IIA (Activin Receptor Type-2A, Activin Receptor Type IIA, ACTR-IIA, ACTRIIA, ACVR2A, ACVR2) (APC)
MBS6002407-02 5x 100 Tests

Activin Receptor Type IIA (Activin Receptor Type-2A, Activin Receptor Type IIA, ACTR-IIA, ACTRIIA, ACVR2A, ACVR2) (APC)

Sign In for Pricing
View Details