Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACRBP Peptide - N-terminal region

ACRBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT23, OY-TES-1, SP32

UniProt

Q8NEB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACRBP Rabbit Polyclonal Antibody (orb584048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115878

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Naphthol-d8
TRC-N368016-5MG 5 mg

2-Naphthol-d8

Sign In for Pricing
View Details
Ephrin B2 (EFNB2) Rabbit Polyclonal Antibody
AP02707PU-S 50 µL

Ephrin B2 (EFNB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(+)-Lupanine Perchlorate
TRC-L474830-1MG 1 mg

(+)-Lupanine Perchlorate

Sign In for Pricing
View Details
Human DIRAS1 activation kit by CRISPRa
GA115663 1 Kit

Human DIRAS1 activation kit by CRISPRa

Sign In for Pricing
View Details
RIP3 Recombinant Rabbit Monoclonal Antibody [PSH04-79]
HA722183 100 µL

RIP3 Recombinant Rabbit Monoclonal Antibody [PSH04-79]

Sign In for Pricing
View Details
TOP2B Antibody
KC-3533-01 50 μL

TOP2B Antibody

Sign In for Pricing
View Details