Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACRBP Peptide - N-terminal region

ACRBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT23, OY-TES-1, SP32

UniProt

Q8NEB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACRBP Rabbit Polyclonal Antibody (orb584048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115878

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBIS (NM_001099671) Human Over-expression Lysate
LC420485 20 µg

RBIS (NM_001099671) Human Over-expression Lysate

Sign In for Pricing
View Details
TECPR1 Antibody
OC-019-01 50 μL

TECPR1 Antibody

Sign In for Pricing
View Details
TECPR1 Antibody
OC-019-02 100 µL

TECPR1 Antibody

Sign In for Pricing
View Details
TECPR1 Antibody
OC-019-03 1 mL

TECPR1 Antibody

Sign In for Pricing
View Details
FAM98B Human qPCR Primer Pair (NM_173611)
HP230922 200 Reactions

FAM98B Human qPCR Primer Pair (NM_173611)

Sign In for Pricing
View Details
3-Keto Fisidic acid
TRC-K188980-5MG 5 mg

3-Keto Fisidic acid

Sign In for Pricing
View Details