CD81 Peptide - C-terminal region
CD81 Peptide - C-terminal region
Product Specifications
UniProt
A6NMH8
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD81 Rabbit Polyclonal Antibody (orb585576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683775-100 1x 100 µL
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1059-100 1x 100 µL
CD71 (TFRC/1059), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041575-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH033121-01 10 µg
Recombinant Human SLAMF3/CD229 Protein (His Tag)
Sign In for Pricing
View Details PKSH033121-02 50 µg
Recombinant Human SLAMF3/CD229 Protein (His Tag)
Sign In for Pricing
View Details