EIF3C Peptide - N-terminal region
EIF3C Peptide - N-terminal region
Product Specifications
UniProt
H3BRV0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF3C Rabbit Polyclonal Antibody (orb586115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NEMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEED
More Discoveries
Explore Other Products
Browse additional items from our catalog
H00120227-P01-2ug 2 µg
Recombinant Human CYP2R1 Protein - (Dry Ice)
Sign In for Pricing
View Details 
