Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3C Peptide - N-terminal region

EIF3C Peptide - N-terminal region

Product Specifications

UniProt

H3BRV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3C Rabbit Polyclonal Antibody (orb586115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEED

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX5 Antibody
A13225-100UG 100 µg

DLX5 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (100312) [Alexa Fluor 488]
FAB6521G 0.1 mL

Mouse Monoclonal IL-2 Antibody (100312) [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit Polyclonal RIP5 Antibody [HRP]
NBP2-99509H 0.1 mL

Rabbit Polyclonal RIP5 Antibody [HRP]

Sign In for Pricing
View Details
Influenza A H5N2 (A/chicken/Iowa/04-20/2015) Hemagglutinin / HA Protein (His Tag)
PO54318I2 100 µg

Influenza A H5N2 (A/chicken/Iowa/04-20/2015) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
PPP3R1 Rabbit pAb
MBS8544139-01 0.1 mL

PPP3R1 Rabbit pAb

Sign In for Pricing
View Details
PPP3R1 Rabbit pAb
MBS8544139-02 0.1 mL (AF405L)

PPP3R1 Rabbit pAb

Sign In for Pricing
View Details