Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMND5B Peptide - N-terminal region

RMND5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

GID2, GID2B

UniProt

Q96G75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RMND5B Rabbit Polyclonal Antibody (orb587737) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073599

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LD78-beta (CCL3L1), His Tag
7-01795 5 µg

Recombinant Human LD78-beta (CCL3L1), His Tag

Sign In for Pricing
View Details
CASP6 Mouse mAb
63192 100 µL

CASP6 Mouse mAb

Sign In for Pricing
View Details
Human SOX9 Protein Lysate
MBS8427659-01 0.02 mg

Human SOX9 Protein Lysate

Sign In for Pricing
View Details
Human SOX9 Protein Lysate
MBS8427659-02 5x 0.02 mg

Human SOX9 Protein Lysate

Sign In for Pricing
View Details
USP14 Antibody (C-term)
E45R04489G-1 100 µL

USP14 Antibody (C-term)

Sign In for Pricing
View Details
TRIAD3 (RNF216) (NM_207111) Human Tagged ORF Clone Lentiviral Particle
RC222602L4V 200 µL

TRIAD3 (RNF216) (NM_207111) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details