RMND5B Peptide - N-terminal region
RMND5B Peptide - N-terminal region
Product Specifications
Product Name Alternative
GID2, GID2B
UniProt
Q96G75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RMND5B Rabbit Polyclonal Antibody (orb587737) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073599
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-2490R-PE-Cy5.5 100 µL
CD23 Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details 
QP6439-ec-1mg 1mg
Recombinant Human Nuclear pore complex protein Nup153 Protein, His, E.coli-1mg
Sign In for Pricing
View Details 
032562-ML405 100 µL
BPHL, ID (BPHL, MCNAA, Valacyclovir hydrolase, Biphenyl hydrolase-like protein, Biphenyl hydrolase-related protein, Breast epithelial mucin-associated antigen) (MaxLight 405) discontinued
Sign In for Pricing
View Details