Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF19B Peptide - C-terminal region

RNF19B Peptide - C-terminal region

Product Specifications

Product Name Alternative

IBRDC3, NKLAM

UniProt

Q6ZMZ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF19B Rabbit Polyclonal Antibody (orb587738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_699172

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIGVPIMLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ror2 Mouse Gene Knockout Kit (CRISPR)
KN314985RB 1 Kit

Ror2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eco1 (ESCO1) Human qPCR Primer Pair (NM_052911)
HP216523 200 Reactions

Eco1 (ESCO1) Human qPCR Primer Pair (NM_052911)

Sign In for Pricing
View Details
Human Carboxylesterase 7 (CES5A) activation kit by CRISPRa
GA116602 1 Kit

Human Carboxylesterase 7 (CES5A) activation kit by CRISPRa

Sign In for Pricing
View Details
RASGRP2 (NM_001098670) Human Over-expression Lysate
LC420662 20 µg

RASGRP2 (NM_001098670) Human Over-expression Lysate

Sign In for Pricing
View Details
Pigment Red 170
TRC-P437805-5G 5 g

Pigment Red 170

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS637983 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details