SEL1L2 Peptide - N-terminal region
SEL1L2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C20orf50, DJ842G6.2, dJ631M13.1
UniProt
Q5TEA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEL1L2 Rabbit Polyclonal Antibody (orb327103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001258468
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GDQLFKMGIKVLQQSKSQKQKEEAYLLFAKAADMGNLKAMEKMADALLFG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C379530-25MG 25 mg
3-(4-Chlorophenyl)-4-hydroxybutyric Acid Sodium Salt
Sign In for Pricing
View Details ![LRRK2 Recombinant Rabbit Monoclonal Antibody [PSH07-96]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea827d3/imageurl/ha722932.webp)
HA722932 100 µL
LRRK2 Recombinant Rabbit Monoclonal Antibody [PSH07-96]
Sign In for Pricing
View Details 
TRC-H297400-25MG 25 mg
1-Hexyl-2-phenyl-4-(1-naphthoyl)pyrroleJWH-147
Sign In for Pricing
View Details 
![PE Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]](https://cdn.genprice.uk/products/763/68dd1499061270361e7ceb4a/imageurl/e-ab-f1112ud.webp)
E-AB-F1112UD-01 25 µg
PE Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
Sign In for Pricing
View Details E-AB-F1112UD-02 100 µg
PE Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
Sign In for Pricing
View Details