SEL1L2 Peptide - N-terminal region
SEL1L2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C20orf50, DJ842G6.2, dJ631M13.1
UniProt
Q5TEA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEL1L2 Rabbit Polyclonal Antibody (orb327103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001258468
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GDQLFKMGIKVLQQSKSQKQKEEAYLLFAKAADMGNLKAMEKMADALLFG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC431670 20 µg
KIBRA (WWC1) (NM_001161661) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSH033724-01 10 µg
Recombinant Human CD40/TNFRSF5 Protein (mFc Tag)
Sign In for Pricing
View Details