SERINC4 Peptide - middle region
SERINC4 Peptide - middle region
Product Specifications
UniProt
A6NH21
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERINC4 Rabbit Polyclonal Antibody (orb587746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001244961
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS073448-01 48 Well
Mouse Microfibrillar Associated Protein 4 ELISA Kit
Sign In for Pricing
View Details MBS073448-02 96 Well
Mouse Microfibrillar Associated Protein 4 ELISA Kit
Sign In for Pricing
View Details MBS073448-03 5x 96 Well
Mouse Microfibrillar Associated Protein 4 ELISA Kit
Sign In for Pricing
View Details MBS073448-04 10x 96 Well
Mouse Microfibrillar Associated Protein 4 ELISA Kit
Sign In for Pricing
View Details