Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERINC4 Peptide - middle region

SERINC4 Peptide - middle region

Product Specifications

UniProt

A6NH21

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERINC4 Rabbit Polyclonal Antibody (orb587746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001244961

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIG-V HDR Plasmid (m)
sc-432993-HDR 20 µg

PIG-V HDR Plasmid (m)

Sign In for Pricing
View Details
Tmem17 ORF Vector (Mouse) (pORF)
ORF059805 1.0 µg DNA

Tmem17 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit
ELK8500MS-01 48 Tests

Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit
ELK8500MS-02 96 Tests

Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit
ELK8500MS-03 5x 96 Tests

Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase 9) Microsample ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), 0.2mg/mL
BNUB2298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), 0.2mg/mL

Sign In for Pricing
View Details