Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFT2D2 Peptide - N-terminal region

SFT2D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UNQ512, dJ747L4.C1.2

UniProt

O95562

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFT2D2 Rabbit Polyclonal Antibody (orb587747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drebrin Antibody
OC-122-01 50 μL

Drebrin Antibody

Sign In for Pricing
View Details
Drebrin Antibody
OC-122-02 100 µL

Drebrin Antibody

Sign In for Pricing
View Details
Drebrin Antibody
OC-122-03 1 mL

Drebrin Antibody

Sign In for Pricing
View Details
NSFL1C Antibody (Center Region)
F53996- 0.05ML 0.05 mL

NSFL1C Antibody (Center Region)

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), 1mg/mL
BNUM1409-50 1x 50 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), 1mg/mL

Sign In for Pricing
View Details
Bis-(1-Chloro-2-propyl)phosphate-d12, 90%
TRC-B419092-1MG 1 mg

Bis-(1-Chloro-2-propyl)phosphate-d12, 90%

Sign In for Pricing
View Details