SFT2D2 Peptide - N-terminal region
SFT2D2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
UNQ512, dJ747L4.C1.2
UniProt
O95562
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SFT2D2 Rabbit Polyclonal Antibody (orb587747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_955376
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BHMT Mouse Monoclonal Antibody [9E1]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80d84/imageurl/em1701-64.webp)
HA610107 100 µg
DNA-PKcs/PRKDC Recombinant Mouse monoclonal Antibody
Sign In for Pricing
View Details 
GP-2402-15 1 mL
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-II-, 15nm
Sign In for Pricing
View Details