Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D21 Peptide - C-terminal region

SH3D21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf113

UniProt

A4FU49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3D21 Rabbit Polyclonal Antibody (orb327105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERAFAQKTRPIKPPPDSQETLALPSLVPQNYTENKNEGVDVTSLRGEVES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADHFE1 Polyclonal Antibody
E-AB-12956-01 20 µL

ADHFE1 Polyclonal Antibody

Sign In for Pricing
View Details
ADHFE1 Polyclonal Antibody
E-AB-12956-02 60 µL

ADHFE1 Polyclonal Antibody

Sign In for Pricing
View Details
ADHFE1 Polyclonal Antibody
E-AB-12956-03 120 µL

ADHFE1 Polyclonal Antibody

Sign In for Pricing
View Details
ADHFE1 Polyclonal Antibody
E-AB-12956-04 200 µL

ADHFE1 Polyclonal Antibody

Sign In for Pricing
View Details
B3GALNT1 Polyclonal Antibody
E-AB-65560-01 60 µL

B3GALNT1 Polyclonal Antibody

Sign In for Pricing
View Details
B3GALNT1 Polyclonal Antibody
E-AB-65560-02 120 µL

B3GALNT1 Polyclonal Antibody

Sign In for Pricing
View Details