Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D21 Peptide - C-terminal region

SH3D21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf113

UniProt

A4FU49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3D21 Rabbit Polyclonal Antibody (orb327105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERAFAQKTRPIKPPPDSQETLALPSLVPQNYTENKNEGVDVTSLRGEVES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP1 (NM_002332) Human Over-expression Lysate
LC400839 20 µg

LRP1 (NM_002332) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HTRA3 activation kit by CRISPRa
GA114318 1 Kit

Human HTRA3 activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-01 20 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-02 100 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-03 2x 100 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF647 conjugate, 0.1mg/mL
BNC470912-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details