SIPA1L2 Peptide - C-terminal region
SIPA1L2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SPAL2
UniProt
Q9P2F8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SIPA1L2 Rabbit Polyclonal Antibody (orb587748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065859
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRQLQTDLRKEKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1893-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1893), 0.2mg/mL
Sign In for Pricing
View Details 
LC400453 20 µg
AdSS 2 (ADSS) (NM_001126) Human Over-expression Lysate
Sign In for Pricing
View Details ![GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI1A3]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90821b/imageurl/cf808006.webp)
CF808006 100 µg
GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI1A3]
Sign In for Pricing
View Details