SIPA1L2 Peptide - C-terminal region
SIPA1L2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SPAL2
UniProt
Q9P2F8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SIPA1L2 Rabbit Polyclonal Antibody (orb587748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065859
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRQLQTDLRKEKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 488 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d025e/imageurl/e-ab-f1112ul.webp)
E-AB-F1112UL-01 25 µg
Elab Fluor® 488 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
Sign In for Pricing
View Details E-AB-F1112UL-02 100 µg
Elab Fluor® 488 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
Sign In for Pricing
View Details 
TP311342L 1 mg
Chimaerin 2 (CHN2) (NM_004067) Human Recombinant Protein
Sign In for Pricing
View Details 