Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R13 Peptide - middle region

TAS2R13 Peptide - middle region

Product Specifications

Product Name Alternative

T2R13, TRB3

UniProt

Q9NYV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R13 Rabbit Polyclonal Antibody (orb587761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076409

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prune Rat shRNA Plasmid (Locus ID 310664)
TR700884 1 Kit

Prune Rat shRNA Plasmid (Locus ID 310664)

Sign In for Pricing
View Details
(1R) -2-chloro-1- (2,4-diisopropylphenyl) ethanol
sc-339291 1 g

(1R) -2-chloro-1- (2,4-diisopropylphenyl) ethanol

Sign In for Pricing
View Details
Dog rabies Antigen rapid test card
LSY-20063 10 Tests/Kit

Dog rabies Antigen rapid test card

Sign In for Pricing
View Details
Recombinant Mouse casp3
orb2296671-01 50 µg

Recombinant Mouse casp3

Sign In for Pricing
View Details
Recombinant Mouse casp3
orb2296671-02 100 µg

Recombinant Mouse casp3

Sign In for Pricing
View Details
Recombinant Mouse casp3
orb2296671-03 200 µg

Recombinant Mouse casp3

Sign In for Pricing
View Details