TAS2R13 Peptide - middle region
TAS2R13 Peptide - middle region
Product Specifications
Product Name Alternative
T2R13, TRB3
UniProt
Q9NYV9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAS2R13 Rabbit Polyclonal Antibody (orb587761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076409
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Yyj6493-500gEcoli 500 µg (E. coli)
Recombinant Schizosaccharomyces Pombe SPBC1604.03c Protein (aa 1-330)
Sign In for Pricing
View Details 
PA2136-1-iFluor647 100 µg
Anti-CD134/OX40/TNFRSF4 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details OM623247 96 Strip Well
Bovine Abhydrolase domain-containing protein FAM108B1 (FAM108B1) ELISA Kit
Sign In for Pricing
View Details