Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TATDN3 Peptide - C-terminal region

TATDN3 Peptide - C-terminal region

Product Specifications

UniProt

Q17R31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TATDN3 Rabbit Polyclonal Antibody (orb587762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSIPPSIIRSGQLLSLFSKKQKLVKQLPLTSICLETDSPALGPEKQQNIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[3- (2,2,2-Trifluoroethyl) phenyl]boronic acid
VPC05682-01 50 mg

[3- (2,2,2-Trifluoroethyl) phenyl]boronic acid

Sign In for Pricing
View Details
[3- (2,2,2-Trifluoroethyl) phenyl]boronic acid
VPC05682-02 0.5 g

[3- (2,2,2-Trifluoroethyl) phenyl]boronic acid

Sign In for Pricing
View Details
ZFYVE27 Adenovirus (Rat)
51232056 1.0 mL

ZFYVE27 Adenovirus (Rat)

Sign In for Pricing
View Details
MUC5B siRNA (Human)
MBS8206661-01 15 nmol

MUC5B siRNA (Human)

Sign In for Pricing
View Details
MUC5B siRNA (Human)
MBS8206661-02 30 nmol

MUC5B siRNA (Human)

Sign In for Pricing
View Details
MUC5B siRNA (Human)
MBS8206661-03 5x 30 nmol

MUC5B siRNA (Human)

Sign In for Pricing
View Details