Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TATDN3 Peptide - C-terminal region

TATDN3 Peptide - C-terminal region

Product Specifications

UniProt

Q17R31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TATDN3 Rabbit Polyclonal Antibody (orb587762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSIPPSIIRSGQLLSLFSKKQKLVKQLPLTSICLETDSPALGPEKQQNIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-2Rα shRNA (h) Lentiviral Particles
sc-29367-V 200 µL

IL-2Rα shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
S100PBP cDNA Clone
MBS1273002-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

S100PBP cDNA Clone

Sign In for Pricing
View Details
S100PBP cDNA Clone
MBS1273002-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

S100PBP cDNA Clone

Sign In for Pricing
View Details
Human ELAPOR1 Protein, His Tag
orb759213-01 1 mg

Human ELAPOR1 Protein, His Tag

Sign In for Pricing
View Details
Human ELAPOR1 Protein, His Tag
orb759213-02 100 µg

Human ELAPOR1 Protein, His Tag

Sign In for Pricing
View Details
Anti-Eva1a Antibody
CQA9917-01 30 µL

Anti-Eva1a Antibody

Sign In for Pricing
View Details