Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf131 Peptide - middle region

C10orf131 Peptide - middle region

Product Specifications

UniProt

A6NCD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C10orf131 Rabbit Polyclonal Antibody (orb327156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQRKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP3 (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNS4 Rabbit Monoclonal Antibody [Clone ID: R06-1F3]
TA422021 100 µL

TNS4 Rabbit Monoclonal Antibody [Clone ID: R06-1F3]

Sign In for Pricing
View Details
TNFAIP3 Goat Polyclonal Antibody
AP22993PU-N 50 µg

TNFAIP3 Goat Polyclonal Antibody

Sign In for Pricing
View Details
TAZ (WWTR1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]
TA503396BM 100 µL

TAZ (WWTR1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]

Sign In for Pricing
View Details
2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine
TRC-D177851-500MG 500 mg

2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine

Sign In for Pricing
View Details
GDI2 Rabbit Polyclonal Antibody
TA376534 100 µL

GDI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details