C10orf131 Peptide - middle region
C10orf131 Peptide - middle region
Product Specifications
UniProt
A6NCD4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C10orf131 Rabbit Polyclonal Antibody (orb327156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQRKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472296-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680950-500 1x 500 µL
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940696-500 1x 500 µL
Cytokeratin 10/13 (DE-K13), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1029-500 1x 500 µL
CD47 (IAP/964 + B6H12.2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![BRCA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]](https://cdn.genprice.uk/products/937/68dd1b78061270361ea1b214/imageurl/ta802628am.webp)
TA802628AM 100 µL
BRCA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
Sign In for Pricing
View Details