Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC30 Peptide - N-terminal region

CCDC30 Peptide - N-terminal region

Product Specifications

UniProt

B4DXQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC30 Rabbit Polyclonal Antibody (orb587823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKVESEVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-15289R-BF680 100 µL

C8orf4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
C6orf58 Antibody - middle region
OAAB00024-400UL 400 µL

C6orf58 Antibody - middle region

Sign In for Pricing
View Details
Human TNFSF9/4-1BBL Antibody, InVivo Block/Neutralizing Antibody
ANT-37421-100ug 100 µg

Human TNFSF9/4-1BBL Antibody, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
Gba Rat shRNA Plasmid (Locus ID 684536)
TL708470 1 Kit

Gba Rat shRNA Plasmid (Locus ID 684536)

Sign In for Pricing
View Details
GFI1B Peptide-C-terminal region
MBS3249469-01 0.1 mg

GFI1B Peptide-C-terminal region

Sign In for Pricing
View Details
GFI1B Peptide-C-terminal region
MBS3249469-02 5x 0.1 mg

GFI1B Peptide-C-terminal region

Sign In for Pricing
View Details