Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM166B Peptide - middle region

FAM166B Peptide - middle region

Product Specifications

UniProt

A8MTA8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM166B Rabbit Polyclonal Antibody (orb327171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157782

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRKDTEKDQVPEPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AJAP1 shRNA (UAS) - Lentiviral human AJAP1 shRNA (UAS) plasmid
GTR15134527 1 Vial

Lentiviral human AJAP1 shRNA (UAS) - Lentiviral human AJAP1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Deoxynucleotide Solution Set
NEB N0446S 25 µmol of Each

Deoxynucleotide Solution Set

Sign In for Pricing
View Details
Rabbit Anti-Human RIMS2 pAb
PA8617-01 50 μL

Rabbit Anti-Human RIMS2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RIMS2 pAb
PA8617-02 100 μL

Rabbit Anti-Human RIMS2 pAb

Sign In for Pricing
View Details
Human Collagen Type XV (COL15) ELISA Kit
MBS458460-01 48 Tests

Human Collagen Type XV (COL15) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type XV (COL15) ELISA Kit
MBS458460-02 96 Tests

Human Collagen Type XV (COL15) ELISA Kit

Sign In for Pricing
View Details