Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLLN Peptide - middle region

KLLN Peptide - middle region

Product Specifications

Product Name Alternative

KILLIN

UniProt

B2CW77

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLLN Rabbit Polyclonal Antibody (orb587840) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001119521

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX52 Antibody
CSB-PA006633GA01HU 100 µL

DDX52 Antibody

Sign In for Pricing
View Details
CD229 Rabbit pAb
MBS8540460-01 0.1 mL

CD229 Rabbit pAb

Sign In for Pricing
View Details
CD229 Rabbit pAb
MBS8540460-02 0.1 mL (AF405L)

CD229 Rabbit pAb

Sign In for Pricing
View Details
CD229 Rabbit pAb
MBS8540460-03 0.1 mL (AF405S)

CD229 Rabbit pAb

Sign In for Pricing
View Details
CD229 Rabbit pAb
MBS8540460-04 0.1 mL (AF610)

CD229 Rabbit pAb

Sign In for Pricing
View Details
CD229 Rabbit pAb
MBS8540460-05 0.1 mL (AF635)

CD229 Rabbit pAb

Sign In for Pricing
View Details