Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLLN Peptide - middle region

KLLN Peptide - middle region

Product Specifications

Product Name Alternative

KILLIN

UniProt

B2CW77

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLLN Rabbit Polyclonal Antibody (orb587840) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001119521

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Rap Guanine Nucleotide Exchange Factor 1 ELISA kit
GTR10432486 96 Well

Guinea Pig Rap Guanine Nucleotide Exchange Factor 1 ELISA kit

Sign In for Pricing
View Details
Phospho-CDK1/CDC2 (Thr161) Blocking Peptide
MBS9619100-01 1 mg

Phospho-CDK1/CDC2 (Thr161) Blocking Peptide

Sign In for Pricing
View Details
Phospho-CDK1/CDC2 (Thr161) Blocking Peptide
MBS9619100-02 5x 1 mg

Phospho-CDK1/CDC2 (Thr161) Blocking Peptide

Sign In for Pricing
View Details
Research Grade Anti-Human VEGFA & ANGPT2 Bispecific Antibody (BI836880)
DHA42310 100 μg

Research Grade Anti-Human VEGFA & ANGPT2 Bispecific Antibody (BI836880)

Sign In for Pricing
View Details
ERK2 IN-5
HY-170526 1 Each

ERK2 IN-5

Sign In for Pricing
View Details
Gan (NM_001107434) Rat Untagged Clone
RN204769 10 µg

Gan (NM_001107434) Rat Untagged Clone

Sign In for Pricing
View Details