Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL1B Peptide - C-terminal region

NEURL1B Peptide - C-terminal region

Product Specifications

UniProt

A8MQ27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEURL1B Rabbit Polyclonal Antibody (orb587844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DPB1 (NM_002121) Human Over-expression Lysate
LY400773 100 µg

HLA-DPB1 (NM_002121) Human Over-expression Lysate

Sign In for Pricing
View Details
Ch25h Mouse Gene Knockout Kit (CRISPR)
KN503227 1 Kit

Ch25h Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705953 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Nsmf Mouse Gene Knockout Kit (CRISPR)
KN311264RB 1 Kit

Nsmf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS800320 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS805057 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details