NEURL1B Peptide - C-terminal region
NEURL1B Peptide - C-terminal region
Product Specifications
UniProt
A8MQ27
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NEURL1B Rabbit Polyclonal Antibody (orb587844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![KRAS Mouse Monoclonal Antibody [A8E6]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea822db/imageurl/ha601060.webp)
GP-6601-5 1 mL
Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-, 5nm
Sign In for Pricing
View Details 