Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-dependent translocase ABCB1 (ABCB1), partial

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243

Abbreviation

Recombinant Human ABCB1 protein, partial

Gene Name

ABCB1

UniProt

P08183

Expression Region

236-297aa

Organism

Homo sapiens (Human)

Target Sequence

LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Molecular Weight

10.8 kDa

References & Citations

Genomic organization of the human multidrug resistance (MDR1) Cloning of P-glycoprotein cDNA sequence from breast cancer MCF7 cell line.Jiang Y., Sun Q., Xie Z., Liu F., Xu W., Wang Y.NIEHS SNPs programComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

6-Ethyl-4-[4-(1,3,4-thiadiazol-2-yl)-1-piperazinyl]thieno[2,3-d]pyrimidine Hydrochloride
TRC-E926745-50MG 50 mg

6-Ethyl-4-[4-(1,3,4-thiadiazol-2-yl)-1-piperazinyl]thieno[2,3-d]pyrimidine Hydrochloride

Ask
View Details
Recombinant Human IL2/ Interleukin-2 Protein, GST, E.coli-500ug
QP6216-ec-500ug 500ug

Recombinant Human IL2/ Interleukin-2 Protein, GST, E.coli-500ug

Ask
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2109565-01 0.1 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Ask
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2109565-02 0.2 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Ask
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2109565-03 0.5 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Ask
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2109565-04 1 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Ask
View Details